PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03110g05009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 328aa    MW: 35079.2 Da    PI: 9.6408
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03110g05009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822218.21.8e-67291582131
                    DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                               +++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+++++ +e++g+sa
  Niben101Scf03110g05009.1  29 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCSRPTPMEIGGTSA 113
                               799********************************************************************************** PP

                    DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsisla 131
                               +++p+ss + s+ ss++asp++sy++sp+sssfpsps+ d +++ 
  Niben101Scf03110g05009.1 114 NITPSSSRHPSPPSSYFASPIPSYQPSPTSSSFPSPSRGDANMSF 158
                               ***************************************998664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.1E-6129155IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MMWEGGGSPA TSSAAAAGGA GGAMGSSSSG RRKPSWRERE NNRRRERRRR AIAAKIYAGL  60
RAQGNYNLPK HCDNNEVLKA LCAEAGWIVE PDGTTYRKGC SRPTPMEIGG TSANITPSSS  120
RHPSPPSSYF ASPIPSYQPS PTSSSFPSPS RGDANMSFHP FAFLHSSIPS SLPPLRISNS  180
APVTPPLSSP TRLPKQTFNL ETLARESMSA LNIPFFAASA PTSPTRGQRF TPATIPECDE  240
SDSSTIDSGQ WMSFQKYATN GVPTSPTFNL IKPAAQRIPS NDMIIDKGKS VEFGFENVSV  300
KAAWEGEKIH EVGLDDLELT LGSGGGRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13049RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781919.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
RefseqXP_016470141.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-113BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB20.0A0A0F6VYB2_NICBE; BES1/BZR1
STRINGSolyc04g079980.2.11e-176(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.28e-92BES1 family protein